Result

Job ID 201504100003588
RCSB PDB ID 1M6B
CHAIN ID A

Synchronize reset

JNN


Confidence Level

Patch Level (ALL)
Confidence of predictions
0=====================1
Color of non-predicteds
=Atom(s) not used in prediction
=Buried atom(s)

color scheme
=Seed atom(s) of interface
=Neighbor atom(s) of interface
=Rest atom(s) of residue patch
=Confidence < 0.2
=Atom(s) not used in prediction
=Buried atom(s)

DownloadDownload

No. PatchScoreShow Patch
116.3772Show residue Patch 1
211.3649Show residue Patch 2
36.8781Show residue Patch 3
46.2529Show residue Patch 4
55.1076Show residue Patch 5
64.2412Show residue Patch 6
73.0740Show residue Patch 7
82.7150Show residue Patch 8
91.8503Show residue Patch 9
101.4366Show residue Patch 10
111.3891Show residue Patch 11
120.4197Show residue Patch 12
AllShow All atom Patchs
Download PatchInfo

Extra information

Sequence View (Color by confidence. Beta testing) [ Detail ]

chain:A
AVCPRCEVVMGNLEIVLTGHNADLSFLQWVREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGP

Residue based prediction

AVCPRCEVVMGNLEIVLTGHNADLSFLQWVREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGP

Density map quality check

Box plots of patchsum

Sequence similarity to training set

Blast result of chain A

Multi-View (beta test)

This page allows you to view all predicted binding sites simultaneously.
[ link ]