Result

Job ID 201504150955276
RCSB PDB ID 1a3r
CHAIN ID H,L

Synchronize reset

JNN


Confidence Level

Patch Level (ALL)
Confidence of predictions
0=====================1
Color of non-predicteds
=Atom(s) not used in prediction
=Buried atom(s)

color scheme
=Seed atom(s) of interface
=Neighbor atom(s) of interface
=Rest atom(s) of residue patch
=Confidence < 0.2
=Atom(s) not used in prediction
=Buried atom(s)

DownloadDownload

No. PatchScoreShow Patch
19.2971Show residue Patch 1
AllShow All atom Patchs
Download PatchInfo

Extra information

Sequence View (Color by confidence. Beta testing) [ Detail ]

chain:H
VQLQQSGAELVRPGASVKLSCTTSGFNIKDIYIHWVKQRPEQGLEWIGRLDPANGYTKYDPKFQGKATITVDTSSNTAYLHLSSLTSEDTAVYYCDGYYSYYDMDYWGPGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
chain:L
DIVMTQSPSSLTVTTGEKVTMTCKSSQSLLNSRTQKNYLTWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLSISGVQAEDLAVYYCQNNYNYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Residue based prediction

VQLQQSGAELVRPGASVKLSCTTSGFNIKDIYIHWVKQRPEQGLEWIGRLDPANGYTKYDPKFQGKATITVDTSSNTAYLHLSSLTSEDTAVYYCDGYYSYYDMDYWGPGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
DIVMTQSPSSLTVTTGEKVTMTCKSSQSLLNSRTQKNYLTWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLSISGVQAEDLAVYYCQNNYNYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Density map quality check

Box plots of patchsum

Sequence similarity to training set

Blast result of chain H
Blast result of chain L

Multi-View (beta test)

This page allows you to view all predicted binding sites simultaneously.
[ link ]

SVM


Confidence Level

Patch Level (ALL)
Confidence of predictions
0=====================1
Color of non-predicteds
=Atom(s) not used in prediction
=Buried atom(s)

color scheme
=Seed atom(s) of interface
=Neighbor atom(s) of interface
=Rest atom(s) of residue patch
=Confidence < 0.2
=Atom(s) not used in prediction
=Buried atom(s)

DownloadDownload

No. PatchScoreShow Patch
142.4884Show residue Patch 1
210.3849Show residue Patch 2
38.7477Show residue Patch 3
46.5889Show residue Patch 4
52.7189Show residue Patch 5
62.5697Show residue Patch 6
72.1541Show residue Patch 7
81.5247Show residue Patch 8
91.0917Show residue Patch 9
101.0721Show residue Patch 10
111.0244Show residue Patch 11
120.9821Show residue Patch 12
130.8156Show residue Patch 13
140.5494Show residue Patch 14
150.4124Show residue Patch 15
160.1547Show residue Patch 16
17-0.0611Show residue Patch 17
18-0.0792Show residue Patch 18
AllShow All atom Patchs
Download PatchInfo

Extra information

Sequence View (Color by confidence. Beta testing) [ Detail ]

chain:H
VQLQQSGAELVRPGASVKLSCTTSGFNIKDIYIHWVKQRPEQGLEWIGRLDPANGYTKYDPKFQGKATITVDTSSNTAYLHLSSLTSEDTAVYYCDGYYSYYDMDYWGPGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
chain:L
DIVMTQSPSSLTVTTGEKVTMTCKSSQSLLNSRTQKNYLTWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLSISGVQAEDLAVYYCQNNYNYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Residue based prediction

Not available

Density map quality check

Box plots of patchsum

Sequence similarity to training set

Blast result of chain H
Blast result of chain L

Multi-View (beta test)

This page allows you to view all predicted binding sites simultaneously.
[ link ]

FANN


Confidence Level

Patch Level (ALL)
Confidence of predictions
0=====================1
Color of non-predicteds
=Atom(s) not used in prediction
=Buried atom(s)

color scheme
=Seed atom(s) of interface
=Neighbor atom(s) of interface
=Rest atom(s) of residue patch
=Confidence < 0.2
=Atom(s) not used in prediction
=Buried atom(s)

DownloadDownload

No. PatchScoreShow Patch
135.1250Show residue Patch 1
210.5643Show residue Patch 2
36.9484Show residue Patch 3
45.5709Show residue Patch 4
52.7833Show residue Patch 5
62.0350Show residue Patch 6
72.0290Show residue Patch 7
81.7700Show residue Patch 8
91.7154Show residue Patch 9
101.3500Show residue Patch 10
111.2528Show residue Patch 11
121.0431Show residue Patch 12
130.9588Show residue Patch 13
140.8895Show residue Patch 14
150.8676Show residue Patch 15
160.8600Show residue Patch 16
170.7699Show residue Patch 17
180.4934Show residue Patch 18
190.2501Show residue Patch 19
200.1723Show residue Patch 20
210.0786Show residue Patch 21
AllShow All atom Patchs
Download PatchInfo

Extra information

Sequence View (Color by confidence. Beta testing) [ Detail ]

chain:H
VQLQQSGAELVRPGASVKLSCTTSGFNIKDIYIHWVKQRPEQGLEWIGRLDPANGYTKYDPKFQGKATITVDTSSNTAYLHLSSLTSEDTAVYYCDGYYSYYDMDYWGPGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
chain:L
DIVMTQSPSSLTVTTGEKVTMTCKSSQSLLNSRTQKNYLTWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLSISGVQAEDLAVYYCQNNYNYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Residue based prediction

Not available

Density map quality check

Box plots of patchsum

Sequence similarity to training set

Blast result of chain H
Blast result of chain L

Multi-View (beta test)

This page allows you to view all predicted binding sites simultaneously.
[ link ]